下载GeneBank文件(.gb)

LOCUS       pcDNA6.2_EmGFP-B        8198 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Vivid Colors(TM) Gateway(R) destination vector for expressing 
            proteins in mammalian cells, with an EmGFP-Bsd fusion as a 
            transfection marker.
ACCESSION   .
VERSION     .
KEYWORDS    pcDNA6.2 EmGFP-Bsd V5-DEST.
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8198)
  AUTHORS   Invitrogen (Life Technologies)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 8198)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8198
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        235..614
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        615..818
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        863..881
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    911..1035
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             complement(1467..1769)
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     CDS             complement(2117..2773)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(2774..2876)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     protein_bind    complement(3054..3178)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             3204..3245
                     /label=V5 tag
                     /note="epitope tag from simian virus 5"
     polyA_signal    3329..3377
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      3579..4007
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4022..4521
                     /label=PGK promoter
                     /note="mouse phosphoglycerate kinase 1 promoter"
     promoter        4535..4582
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             4601..5317
                     /label=EmGFP
                     /note="Emerald GFP"
     CDS             5318..5713
                     /codon_start=1
                     /gene="Aspergillus terreus BSD"
                     /product="blasticidin S deaminase"
                     /label=Aspergillus terreus BSD
                     /note="BSD"
                     /note="confers resistance to blasticidin"
                     /translation="AKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTGV
                     NVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGIK
                     AIVKDSDGQPTAVGIRELLPSGYVWEG"
     polyA_signal    5871..6004
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(6041..6057)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(6065..6081)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6089..6119)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6134..6155)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6443..7031)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7205..8062)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(8063..8167)
                     /label=AmpR promoter