A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH. In addition, downstream of Pln NC8, it is likely there is another two chain bacteriocin named plantaricin J51. Whether it is a true bacteriocin remains to be established (Diep DB et al, 2009). Plantaricin NC8 has Antimicrobial activity. The source of Plantaricin NC8 is Lactobacillus plantarum NC8.
Maldonado A, Ruiz-Barba JL, Jiménez-Díaz R. Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8. Appl Environ Microbiol. 2003 Jan;69(1):383-9.