A two chain bacteriocin. Shown is the sequence for chain a. The peptide sequence for chain b is GFWGGLGYIAGRVGAAYGHAQASANNHHSPING. Lactocin 705 has Antimicrobial activity. The source of Lactocin 705 is Lactobacillus casei CRL 705.
Cuozzo SA, Sesma F, Palacios JM, de Ruíz Holgado AP, Raya RR. Identification and nucleotide sequence of genes involved in the synthesis of lactocin 705, a two-peptide bacteriocin from Lactobacillus casei CRL 705. FEMS Microbiol Lett. 2000 Apr 15;185(2):157-61.