A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH. Plantaricin NC8 alpha peptide was found in bacterium (Lactobacillus plantarum).
Navarro L, Rojo-bezares B, Sáenz Y, et al. Comparative study of the pln locus of the quorum-sensing regulated bacteriocin-producing L. plantarum J51 strain. Int J Food Microbiol. 2008;128(2):390-4.