下载GeneBank文件(.gb)

LOCUS       pEarleyGate_205.       12188 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Gateway(R)-compatible plant transformation vector with a C-terminal 
            TAP tag.
ACCESSION   .
VERSION     .
KEYWORDS    pEarleyGate 205.
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12188)
  AUTHORS   Earley KW, Haag JR, Pontes O, Opper K, Juehne T, Song K, Pikaard CS.
  TITLE     Gateway-compatible vectors for plant functional genomics and 
            proteomics.
  JOURNAL   Plant J. 2006;45:616-29.
  PUBMED    16441352
REFERENCE   2  (bases 1 to 12188)
  AUTHORS   Pikaard Lab
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 12188)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; 
            date: "2006"; volume: "45"; pages: "616-29"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     The sequence was corrected by inserting a G at position 8296.
FEATURES             Location/Qualifiers
     source          1..12188
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..25
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     terminator      complement(111..363)
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     CDS             complement(376..924)
                     /label=BlpR
                     /note="phosphinothricin acetyltransferase"
     promoter        complement(930..1310)
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     promoter        2306..2651
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     protein_bind    2663..2782
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        2812..2842
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             2896..3552
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             3897..4199
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(4243..4367)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             4381..4458
                     /label=CBP
                     /note="calmodulin-binding peptide"
     CDS             4486..4506
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     CDS             4546..4719
                     /label=ProtA
                     /note="IgG-binding unit of Staphylococcus aureus protein A"
     CDS             4720..4893
                     /codon_start=1
                     /product="IgG-binding unit of Staphylococcus aureus protein
                     A"
                     /label=IgG-binding unit of Staphylococcus aureus prote
                     /note="ProtA"
                     /translation="VDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLL
                     AEAKKLNGAQAPK"
     terminator      4959..5666
                     /label=OCS terminator
                     /note="octopine synthase terminator"
     misc_feature    5910..5934
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             7234..7860
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             8292..9362
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      9431..9625
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    9969..10109
                     /label=bom
                     /note="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(10295..10883)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(10973..11764)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"